Sermorelin
CAS:86168-78-7
MF: C149H246N44O42S
It is licensed as a diagnostic test for secretion of growth. It is also used for the treatment of growth deficiency in children.
- Description
- Наша политика
- Дополнительная информация
Description
Sermorelin (GHRH) CAS 86168-78-7 Информация о товаре
| Наименование товара: | Sermorelin |
| Синонимы: | SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) |
| № КАС: | 86168-78-7 |
| Молекулярная масса: | 3357.93 |
| Молекулярная формула: | C149H246N44O42S |
| Плотность: | 1.45±0.1 g/cm3(Predicted) |
| Температура плавления: | >189°C (dec.) |
| Появление: | От белого до почти белого сплошного цвета |
| Растворимость: | Прозрачная бесцветная жидкость |
| Хранилище: | −20°C |
sermorelin side effects/side effects of sermorelin
The most common side effect of sermorelin is caused by its injection under your skin. You may experience any of the following at the site of injection:
irritation,itching,sensitivity,swelling,pain,redness.
cjc 1295 vs sermorelin
sermorelin and CJC-1295 differ in their half-lives. Having a greater half-life means CJC-1295 can stay in serum for a longer time and show prolonged effects compared to sermorelin.
sermorelin dosage bodybuilding
| Option | Dosage | Timing/Duration | Reasoning |
| Opt. 1 | 0.5 – 1.0mg x 2 per day | 2 – 4 months | Increase in basal HGH and IGF |
| Opt. 2 | 0.3mcg per kg x 1 per day | 2 – 4 months | Increase in basal HGH and IGF |
| Opt. 3 | 2.0 – 3.0mg x 1 per day (Before cardio) | 2 – 4 months | Fat loss |
| Opt. 4 | 2.0 – 3.0mg x 1 per day (After weights) | 2 – 4 months | Muscle gain |
sermorelin dosage/sermorelin dose
A dosage of 0.2 – 0.3 mcg once daily at bedtime by subcutaneous injection is recommended. It is also recommended that subcutaneous injection sites be periodically rotated.
Does sermorelin work?
Unfortunately, this is not a treatment that works overnight. It will take at least a few months, typically 3-6, for the treatment to work. You will notice that some benefits come sooner or later than others. This is normal.
benefits of sermorelin
Sermorelin therapy benefits include: Increase in muscle mass development after exercise, faster recovery from strenuous exercise, increased energy and endurance, better strength, and joint and muscle pain relief for patients with arthritis and chronic pain.
sermorelin for females
Women who take sermorelin see many physical, emotional and mental improvements over time, including: Weight loss, including the decrease of belly fat and cellulite. Tightening and softening of the skin, eliminating most visible signs of aging (like wrinkles) Improved mood and fewer mood swings.
sermorelin ipamorelin results
While results of using Sermorelin & IPA may vary from one patient to another, studies have shown that the anti-aging treatment of this combination peptides leads to a vast range of mental and physical benefits which include: The increase of lean-body mass. Body fat reduction. Improved energy in the body.
sermorelin for weight loss
Research has proven that sermorelin therapy helps the body burn fat and increases energy levels. With higher energy levels, the body rids itself of excess fat and allows for muscle gain. This is a result of the sermorelin helping out with the body’s natural production of growth levels.
sermorelin vs hgh/sermorelin hgh
HGH injections provide the body with an immediate supply of human gh.Sermorelin promotes the production of increased gh by the pituitary gland. The effects take up to a few months as the increase in GH production takes time to influence change.
tesamorelin vs sermorelin
Tesamorelin is a 3rd generation GHRH stabilized synthetic peptide analogue of the hypothalamic peptide. It stimulates the synthesis and release of endogenous GH, with an increase in the level of insulin-like growth factor.
sermorelin vs ipamorelin/ipamorelin vs sermorelin
Although both peptides are pretty similar in terms of their end functioning, there still lies a significant difference in the mechanism of action.
We are Chinese professional supplier of sermorelin.We can give you the sermorelin best price.Welcome to inquiry!
| Время пробега | Обычно вы получите посылку в течение 7–15 рабочих дней после отправки (это может быть отложено в особых обстоятельствах, например, в китайский Новый год). |
| Способ получения | Обычно мы отправляем товар курьером или специальной линией, конечно, если сам товар на местном складе есть, также поддерживаем самовывоз, в зависимости от обстоятельств. |
| Зарубежный склад | У нас есть зарубежные склады в некоторых европейских странах и Австралии, таких как Германия, Россия и Австралия. |
| способ доставки | WGP будет доставляться через курьерские компании, такие как DHL, FedEx, UPS, TNT или EMS. |
| О послепродажном обслуживании | Если в течение 7 дней с момента получения товара вы обнаружите какие-либо проблемы с товаром (сломанная упаковка, меньше волос и т. д.), пожалуйста, свяжитесь с нашим отделом продаж, мы поможем вам справиться с этим вовремя. |
Дополнительная информация
| Color | White |
|---|---|
| Form | Powder |
Отзывы
Пока нет отзывов.