PeptidesSynthetic PeptidesSermorelin (GHRH) CAS 86168-78-7

Sermorelin (GHRH) CAS 86168-78-7 Product Information

Product Name:	Sermorelin
Synonyms:	SERMORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS NO:	86168-78-7
Molecular Weight:	3357.93
Molecular Formula:	C149H246N44O42S
Density:	1.45±0.1 g/cm3(Predicted)
Melting point:	>189°C (dec.)
Appearance:	White to Off-White Solid
Solubility:	Clear colorless Liquid
Storage:	−20°C

sermorelin side effects/side effects of sermorelin

The most common side effect of sermorelin is caused by its injection under your skin. You may experience any of the following at the site of injection:
irritation,itching,sensitivity,swelling,pain,redness.

cjc 1295 vs sermorelin

sermorelin and CJC-1295 differ in their half-lives. Having a greater half-life means CJC-1295 can stay in serum for a longer time and show prolonged effects compared to sermorelin.

sermorelin dosage bodybuilding

Option	Dosage	Timing/Duration	Reasoning
Opt. 1	0.5 – 1.0mg x 2 per day	2 – 4 months	Increase in basal HGH and IGF
Opt. 2	0.3mcg per kg x 1 per day	2 – 4 months	Increase in basal HGH and IGF
Opt. 3	2.0 – 3.0mg x 1 per day (Before cardio)	2 – 4 months	Fat loss
Opt. 4	2.0 – 3.0mg x 1 per day (After weights)	2 – 4 months	Muscle gain

sermorelin dosage/sermorelin dose

A dosage of 0.2 – 0.3 mcg once daily at bedtime by subcutaneous injection is recommended. It is also recommended that subcutaneous injection sites be periodically rotated.

Does sermorelin work?

Unfortunately, this is not a treatment that works overnight. It will take at least a few months, typically 3-6, for the treatment to work. You will notice that some benefits come sooner or later than others. This is normal.

benefits of sermorelin

Sermorelin therapy benefits include: Increase in muscle mass development after exercise, faster recovery from strenuous exercise, increased energy and endurance, better strength, and joint and muscle pain relief for patients with arthritis and chronic pain.

sermorelin for females

Women who take sermorelin see many physical, emotional and mental improvements over time, including: Weight loss, including the decrease of belly fat and cellulite. Tightening and softening of the skin, eliminating most visible signs of aging (like wrinkles) Improved mood and fewer mood swings.

sermorelin ipamorelin results

While results of using Sermorelin & IPA may vary from one patient to another, studies have shown that the anti-aging treatment of this combination peptides leads to a vast range of mental and physical benefits which include: The increase of lean-body mass. Body fat reduction. Improved energy in the body.

sermorelin for weight loss

Research has proven that sermorelin therapy helps the body burn fat and increases energy levels. With higher energy levels, the body rids itself of excess fat and allows for muscle gain. This is a result of the sermorelin helping out with the body’s natural production of growth  levels.

sermorelin vs hgh/sermorelin hgh

HGH injections provide the body with an immediate supply of human gh.Sermorelin promotes the production of increased gh by the pituitary gland. The effects take up to a few months as the increase in GH production takes time to influence change.

tesamorelin vs sermorelin

Tesamorelin is a 3rd generation GHRH  stabilized synthetic peptide analogue of the hypothalamic peptide. It stimulates the synthesis and release of endogenous GH, with an increase in the level of insulin-like growth factor.

sermorelin vs ipamorelin/ipamorelin vs sermorelin

Although both peptides are pretty similar in terms of their end functioning, there still lies a significant difference in the mechanism of action.

We are Chinese professional supplier of sermorelin.We can give you the sermorelin best price.Welcome to inquiry!