CJC 1295 NO DAC
CAS:863288-34-0
MF: C152H252N44O42
CJC-1295 is an incredibly effective growth and works by causing another substance to be secreted. It stimulates the release of your own body’s growth which. Research show that after the age of 30 the body’s growth level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth naturally by binding to receptors for growth releasing hormone (GHRH) on your brain and more specifically the pituitary gland.
- Description
- Additional information
Description
CJC 1295 NO DAC CAS 863288-34-0 Product Information
| Product Name: | CJC 1295 NO DAC |
| Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
| CAS NO: | 863288-34-0 |
| Molecular Weight: | 3367.89688 |
| Molecular Formula: | C152H252N44O42 |
| Melting point: | > 177° C (dec.) |
| Density: | 1.45 |
| Appearance: | White to Off-White Solid |
| Solubility: | Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly) |
| Storage: | -20°C Freezer, Under inert atmosphere |
What is cjc 1295 no dac?
CJC 1295 without DAC, or Modified growth releasing factor 1 through 29 (MOD GRF 1-29) is a synthetic analogue of the hormone referred to as GHRH. Growth that is internally created within the body has 44 amino acids as part of its structure. Another common peptide which is a shortened variation of GHRH is Sermorelin, which is also called GRF 1-29. Keep in mind that GRF 1-29 and MOD GRF 1-29 are not the same. In fact, CJC 1295 without DAC is actually further modified from the GRF 1-29 stage. What that means is that 4 specific amino acids in the chain have been further altered for better stability.
cjc 1295 no dac vs sermorelin
Despite having almost identical chemical structure and functional properties, Sermorelin and CJC-1295 still have differences especially when it comes to their pharmacokinetic properties like half-life, potency, and mechanism of action.
cjc 1295 no dac vs dac/cjc 1295 dac vs no dac/cjc 1295 with or without dac
CJC-1295 + DAC vs. CJC-1295 no DAC. CJC-1295 + DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Releasing Hormones (GHRH). Their action in the human body is identical but the difference between the two peptides are the span of the half-life.
cjc 1295 no dac dosage bodybuilding/cjc 1295 without dac dosage
Since CJC 1295 without DAC tends to have a relatively short half-life of thirty minutes, you can get away with between one and three doses of it per day. Each dose would consist of roughly 100mcg or 0.1mg.
cjc 1295 no dac side effects
In most cases, side effects are mild, and they tend to dissipate as time goes on. The most common side effects may be sensitivity around the injection sites as well as dizziness, nausea, fatigue, and flushing. Typically, these side effects occur more when a higher dose than recommended is used.
cjc 1295 no dac for women
Either way, we’ve noticed that CJC 1295 + Ipamorelin is great for increasing fat loss. Keep reading to learn more about how CJC-1295 + Ipamorelin is one of the best peptides for female fat loss.
cjc 1295 no dac benefits
Dozens of benefits can come from the use of CJC 1295 w/o DAC, for one since it has one of the shortest half-lives it acts more naturally within the body.Fat Reduction,Lean Muscle Gain,Faster Recovery,Improved Immune Health,Improved Cellular Repair,Healthier Hair, Skin, & Nails.
cjc 1295 without dac half life
thirty minutes
Additional information
| Color | White |
|---|
Reviews
There are no reviews yet.